Lineage for d6ibra2 (6ibr A:324-421)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2420138Protein Melibiase [75020] (4 species)
  7. 2420142Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries)
    alpha-galactosidase A
  8. 2420155Domain d6ibra2: 6ibr A:324-421 [375363]
    Other proteins in same PDB: d6ibra1, d6ibrb1
    automated match to d1r46a1
    complexed with act, bma, edo, hbe, man, nag, peg, so4

Details for d6ibra2

PDB Entry: 6ibr (more details), 2.02 Å

PDB Description: crystal structure of human alpha-galactosidase a in complex with alpha-galactose configured cyclophellitol epoxide lwa481
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d6ibra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ibra2 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentm

SCOPe Domain Coordinates for d6ibra2:

Click to download the PDB-style file with coordinates for d6ibra2.
(The format of our PDB-style files is described here.)

Timeline for d6ibra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ibra1