SCOPe 2.08: Domain d6hjyf1: 6hjy F:6-124

Lineage for d6hjyf1 (6hjy F:6-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6hjyf1: 6hjy F:6-124 [375357]
   Other proteins in same PDB: d6hjyf2, d6hjyj2
   automated match to d5da4a_
   mutant

Details for d6hjyf1

PDB Entry: 6hjy, 2.78 Å

PDB Description: x-ray structure of a pentameric ligand gated ion channel from erwinia chrysanthemi (elic) delta8 truncation mutant in complex with nanobody 72

PDB Compounds: (F:) nanobody 72

SCOPe Domain Sequences for d6hjyf1:

Sequence; same for both SEQRES and ATOM records:

>d6hjyf1 b.1.1.1 (F:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvyadfvk
grftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvtvss

Timeline for d6hjyf1:

• d6hjyf1 first appeared in SCOPe 2.07