![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Melibiase [75020] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries) alpha-galactosidase A |
![]() | Domain d6ibtb2: 6ibt B:324-423 [375354] Other proteins in same PDB: d6ibta1, d6ibtb1 automated match to d1r46b1 complexed with act, bma, edo, h9t, man, nag, peg, so4 |
PDB Entry: 6ibt (more details), 2.04 Å
SCOPe Domain Sequences for d6ibtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ibtb2 b.71.1.1 (B:324-423) Melibiase {Human (Homo sapiens) [TaxId: 9606]} lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf itqllpvkrklgfyewtsrlrshinptgtvllqlentmqm
Timeline for d6ibtb2: