Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Fervidobacterium islandicum [TaxId:2423] [375281] (2 PDB entries) |
Domain d6a6ea1: 6a6e A:1-421 [375344] Other proteins in same PDB: d6a6ea2, d6a6eb2, d6a6ec2, d6a6ed2 automated match to d5xt5b_ complexed with cit, gol, peg, plp |
PDB Entry: 6a6e (more details), 2.09 Å
SCOPe Domain Sequences for d6a6ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a6ea1 c.67.1.0 (A:1-421) automated matches {Fervidobacterium islandicum [TaxId: 2423]} mrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyhysni hravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgilkted tvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvvsitg qsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgptgig vlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgytidyle sigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvshilde nfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyirrwf e
Timeline for d6a6ea1: