SCOPe 2.07: Domain d6a6ea1: 6a6e A:1-421

Lineage for d6a6ea1 (6a6e A:1-421)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Fervidobacterium islandicum [TaxId:2423] [375281] (2 PDB entries)

8. Domain d6a6ea1: 6a6e A:1-421 [375344]
   Other proteins in same PDB: d6a6ea2, d6a6eb2, d6a6ec2, d6a6ed2
   automated match to d5xt5b_
   complexed with cit, gol, peg, plp

Details for d6a6ea1

PDB Entry: 6a6e, 2.09 Å

PDB Description: crystal structure of thermostable cysteine desulfurase (fisufs) from thermophilic fervidobacterium islandicum aw-1

PDB Compounds: (A:) Cysteine desulfurase

SCOPe Domain Sequences for d6a6ea1:

Sequence; same for both SEQRES and ATOM records:

>d6a6ea1 c.67.1.0 (A:1-421) automated matches {Fervidobacterium islandicum [TaxId: 2423]}
mrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyhysni
hravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgilkted
tvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvvsitg
qsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgptgig
vlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgytidyle
sigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvshilde
nfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyirrwf
e

Timeline for d6a6ea1:

• d6a6ea1 is new in SCOPe 2.07-stable
  
• d6a6ea1 appears in the current release, SCOPe 2.08