Lineage for d6a6ed1 (6a6e D:1-421)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897173Species Fervidobacterium islandicum [TaxId:2423] [375281] (2 PDB entries)
  8. 2897177Domain d6a6ed1: 6a6e D:1-421 [375341]
    Other proteins in same PDB: d6a6ea2, d6a6eb2, d6a6ec2, d6a6ed2
    automated match to d5xt5b_
    complexed with cit, gol, peg, plp

Details for d6a6ed1

PDB Entry: 6a6e (more details), 2.09 Å

PDB Description: crystal structure of thermostable cysteine desulfurase (fisufs) from thermophilic fervidobacterium islandicum aw-1
PDB Compounds: (D:) Cysteine desulfurase

SCOPe Domain Sequences for d6a6ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a6ed1 c.67.1.0 (D:1-421) automated matches {Fervidobacterium islandicum [TaxId: 2423]}
mrstvfsdeefsnilndfpalkrningkrlvyldnaastlkcksviekmtdfylyhysni
hravhtlaseatvayeqarekvanflnasseeiiftsgttmginflvnslaksgilkted
tvlisqvehhanlvpwvrlskfygfkvayitadekgvitnesilktkesipnpkvvsitg
qsnvtgqempieliretfknatlivdgaqlvphkkvdvkkldvdflvfsghkilgptgig
vlygkkalleqlepflyggemidkvtfedvtfnvlpyrfeagtqhitgavglgytidyle
sigfekvekhveelsnyllekmmeldfvevygpidsshkslvsfnvkgvhphdvshilde
nfgvatrsghhcaqplmgvlakgskidfpnstvrasvylyntkedidvlieglkyirrwf
e

SCOPe Domain Coordinates for d6a6ed1:

Click to download the PDB-style file with coordinates for d6a6ed1.
(The format of our PDB-style files is described here.)

Timeline for d6a6ed1: