Lineage for d6s02b2 (6s02 B:221-414)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493223Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)
  8. 2493255Domain d6s02b2: 6s02 B:221-414 [375228]
    automated match to d3fe1a2
    complexed with adp, mg

Details for d6s02b2

PDB Entry: 6s02 (more details), 1.87 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain - adp bound state
PDB Compounds: (B:) Heat shock protein 70

SCOPe Domain Sequences for d6s02b2:

Sequence, based on SEQRES records: (download)

>d6s02b2 c.55.1.0 (B:221-414) automated matches {Plasmodium falciparum [TaxId: 36329]}
geqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkkng
gkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcmdq
frntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpdeav
aygaavqaailsgd

Sequence, based on observed residues (ATOM records): (download)

>d6s02b2 c.55.1.0 (B:221-414) automated matches {Plasmodium falciparum [TaxId: 36329]}
geqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkkng
gknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcmdqfrnt
lipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpdeavayga
avqaailsgd

SCOPe Domain Coordinates for d6s02b2:

Click to download the PDB-style file with coordinates for d6s02b2.
(The format of our PDB-style files is described here.)

Timeline for d6s02b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6s02b1