Lineage for d6popd1 (6pop D:2-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909595Species Pseudoalteromonas fuliginea [TaxId:1872678] [375103] (2 PDB entries)
  8. 2909600Domain d6popd1: 6pop D:2-475 [375172]
    Other proteins in same PDB: d6popa2, d6popb2, d6popc2, d6popd2, d6pope2, d6popf2
    automated match to d4qeta_
    complexed with edo, mg, nap

Details for d6popd1

PDB Entry: 6pop (more details), 2.15 Å

PDB Description: crystal structure of daua in complex with nadp+
PDB Compounds: (D:) aldehyde dehydrogenase

SCOPe Domain Sequences for d6popd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6popd1 c.82.1.0 (D:2-475) automated matches {Pseudoalteromonas fuliginea [TaxId: 1872678]}
lskqlyiggklitsdatteiinpatleivgeisaagineanmalesaqeafsswsttpai
eraqwmlklrdavianeqhlrecvhlemakpwqstaddfqmlvdslnfyadaivniadee
ikdnegthshvlsrepvgvaaaflawnfpllnlayklgpamaagcplvvkpssktplsay
avgelceqiglpagvvnilsgmdstvgdaisastipsvltligstnvgkhviatgatsik
rysmelggnapaivcsdanldnaadvicgvkfanagqicvtpnrvfvhesvadefiekvl
trakavkvgfdkneaidmgpvmdanswqridelvkdaqqngaqlqlggkkptgvngyfye
ptvltnvdssmkiykdeifgpvisiiifsdneqvlsdandtdaglssfifssnedtisyf
akhlrfgevqvngikysinlphfgikqsgvgvdcsllalddylaykrvsralkv

SCOPe Domain Coordinates for d6popd1:

Click to download the PDB-style file with coordinates for d6popd1.
(The format of our PDB-style files is described here.)

Timeline for d6popd1: