SCOPe 2.08: Domain d6nj6b1: 6nj6 B:3-260

Lineage for d6nj6b1 (6nj6 B:3-260)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (974 PDB entries)
   Uniprot P00918

8. Domain d6nj6b1: 6nj6 B:3-260 [375024]
   Other proteins in same PDB: d6nj6a2, d6nj6b2
   automated match to d2foua_
   complexed with gol, moh, so4, zn

Details for d6nj6b1

PDB Entry: 6nj6, 1.6 Å

PDB Description: thermostable variant of human carbonic anhydrase with tetrazine 2.0 at site 186 reacted with stco in crystallo

PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d6nj6b1:

Sequence; same for both SEQRES and ATOM records:

>d6nj6b1 b.74.1.1 (B:3-260) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
htfnvefddsqdkavlkggpldgtyrliqfhfhwgshdgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsanpglqkvvdvldsiktkgksadftnfdprgl
lpxsldywtypgslttppllecvtwivlkepisvsseqvskfrklnfngegepeepmvdn
wrptqplknrqikasfk

Timeline for d6nj6b1:

• d6nj6b1 first appeared in SCOPe 2.07