Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.2: L15e [54193] (1 protein) elaborated with additional structures |
Protein Ribosomal protein L15e [54194] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (40 PDB entries) |
Domain d1ffki_: 1ffk I: [37494] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffki_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffki_ d.12.1.2 (I:) Ribosomal protein L15e {Archaeon Haloarcula marismortui [TaxId: 2238]} mksmyayireawkrpyegyvgelmwhrlqkwrrepavvriprptrldraralgykakkgi ivvrvrirrggrratrpnkgrkskkmmvnrrprkknlqwiaeeranrkypnmevlnsywv gedgrykwfevilvdrdhpaiksdpqlswvsrtrgrvyrgltsagrkarglrrkgrgaek vrpslranfrkkrr
Timeline for d1ffki_:
View in 3D Domains from other chains: (mouse over for more information) d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ |