Lineage for d6sged1 (6sge D:2-128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754545Domain d6sged1: 6sge D:2-128 [374922]
    Other proteins in same PDB: d6sgea_, d6sgeb2, d6sgec_, d6sged2, d6sged3
    automated match to d4nbzb_
    complexed with gtp, mg

Details for d6sged1

PDB Entry: 6sge (more details), 1.5 Å

PDB Description: crystal structure of human rhob-gtp in complex with nanobody b6
PDB Compounds: (D:) Nanobody B6

SCOPe Domain Sequences for d6sged1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sged1 b.1.1.0 (D:2-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlqasgggfvqpggslrlscaasgygstietmgwfrqapgkerefvsaisrapgpsqyy
adsvkgrftisrdnskntvylqmnslraedtatyycapinnrtmqdsmflwnywgqgtqv
tvssaaa

SCOPe Domain Coordinates for d6sged1:

Click to download the PDB-style file with coordinates for d6sged1.
(The format of our PDB-style files is described here.)

Timeline for d6sged1: