Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Kallikrein 6 [74974] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74975] (17 PDB entries) |
Domain d6skcb_: 6skc B: [374913] automated match to d4d8na_ complexed with ben, gol, lh8 |
PDB Entry: 6skc (more details), 2.18 Å
SCOPe Domain Sequences for d6skcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6skcb_ b.47.1.2 (B:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl vcgdhlrglvswgnypcgskekpgvytnvcrytnwiqktiqa
Timeline for d6skcb_: