Lineage for d1e0ba_ (1e0b A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188772Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 188938Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. 188956Family d.9.2.2: Chromo domain [54165] (2 proteins)
  6. 188957Protein Heterochromatin protein 1, HP1 [54166] (3 species)
  7. 188958Species Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId:4896] [54169] (1 PDB entry)
  8. 188959Domain d1e0ba_: 1e0b A: [37476]

Details for d1e0ba_

PDB Entry: 1e0b (more details), 1.9 Å

PDB Description: chromo shadow domain from fission yeast swi6 protein.

SCOP Domain Sequences for d1e0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ba_ d.9.2.2 (A:) Heterochromatin protein 1, HP1 {Fission yeast (Schizosaccharomyces pombe), SWI6}
qvenydswedlvssidtierkddgtleiyltwkngaishhpstitnkkcpqkmlqfyesh
l

SCOP Domain Coordinates for d1e0ba_:

Click to download the PDB-style file with coordinates for d1e0ba_.
(The format of our PDB-style files is described here.)

Timeline for d1e0ba_: