Lineage for d6hxua_ (6hxu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (34 species)
    not a true protein
  7. 2448966Species Human (Homo sapiens) [TaxId:9606] [186768] (278 PDB entries)
  8. 3074518Domain d6hxua_: 6hxu A: [374580]
    automated match to d4f38a_
    complexed with gtp, mg

Details for d6hxua_

PDB Entry: 6hxu (more details), 1.19 Å

PDB Description: crystal structure of human rhob q63l in complex with gtp
PDB Compounds: (A:) Rho-related GTP-binding protein RhoB

SCOPe Domain Sequences for d6hxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hxua_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aairkklvvvgdgacgktcllivfskdefpevyvptvfenyvadievdgkqvelalwdta
gledydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdl
rsdehvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalqk
ry

SCOPe Domain Coordinates for d6hxua_:

Click to download the PDB-style file with coordinates for d6hxua_.
(The format of our PDB-style files is described here.)

Timeline for d6hxua_:

  • d6hxua_ is new in SCOPe 2.07-stable