Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
Domain d6cu6a1: 6cu6 A:1-168 [374575] Other proteins in same PDB: d6cu6a2, d6cu6b2, d6cu6c2 automated match to d5us4a_ complexed with gnp, gol, mg; mutant |
PDB Entry: 6cu6 (more details), 1.5 Å
SCOPe Domain Sequences for d6cu6a1:
Sequence, based on SEQRES records: (download)
>d6cu6a1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
>d6cu6a1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlps rtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
Timeline for d6cu6a1:
View in 3D Domains from other chains: (mouse over for more information) d6cu6b1, d6cu6b2, d6cu6c1, d6cu6c2 |