SCOPe 2.08: Domain d6u8ja1: 6u8j A:1-371

Lineage for d6u8ja1 (6u8j A:1-371)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein automated matches [190083] (10 species)
   not a true protein

7. Species Candida auris [TaxId:498019] [374484] (2 PDB entries)

8. Domain d6u8ja1: 6u8j A:1-371 [374505]
   Other proteins in same PDB: d6u8ja2, d6u8jb2, d6u8jc2, d6u8jd2, d6u8je2, d6u8jf2, d6u8jg2
   automated match to d5cksb_
   complexed with unx

Details for d6u8ja1

PDB Entry: 6u8j, 2.49 Å

PDB Description: crystal structure of 3-deoxy-d-arabinoheptulosonate-7-phosphate synthase/phospho-2-dehydro-3-deoxyheptonate aldolase (aro3) from candida auris

PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d6u8ja1:

Sequence; same for both SEQRES and ATOM records:

>d6u8ja1 c.1.10.4 (A:1-371) automated matches {Candida auris [TaxId: 498019]}
mfiqnehvgdrsrmedwrirgydplappdllqhefplsdknkdiilkgredtcnilngkd
drlivvigpcsihdpeaaldyadrlhklsekhkgelhivmraylekprttvgwkglindp
didgsfqinkglriarkmfvqlteklpiagemldtispqflsdlfsvgaigarttesqlh
relasglsfpvgfkngtdgtlgvaidalraashphhflsvtkpgivsivgtegnqdcfvi
lrggkqgtnydaksvketkealakakvvdpenpkprimvdcshgnsnknhknqplvaadv
akqisegedqicglmiesninegrqdvppadkggkealkygcsitdacigiddtesvlet
laqaikarrgl

Timeline for d6u8ja1:

• d6u8ja1 first appeared in SCOPe 2.07