Lineage for d6p5da_ (6p5d A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2576906Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 2576907Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 2576908Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (82 PDB entries)
    Uniprot P16113
  8. 2576964Domain d6p5da_: 6p5d A: [374325]
    automated match to d1nwza_
    complexed with 60f

Details for d6p5da_

PDB Entry: 6p5d (more details), 1.6 Å

PDB Description: photoactive yellow protein pyp 30ps
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d6p5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p5da_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapxtdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOPe Domain Coordinates for d6p5da_:

Click to download the PDB-style file with coordinates for d6p5da_.
(The format of our PDB-style files is described here.)

Timeline for d6p5da_: