SCOPe 2.08: Domain d6jy4c_: 6jy4 C:

Lineage for d6jy4c_ (6jy4 C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)

8. Domain d6jy4c_: 6jy4 C: [374233]
   Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_
   automated match to d1v54c_
   complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn

Details for d6jy4c_

PDB Entry: 6jy4, 1.95 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully reduced state

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d6jy4c_:

Sequence; same for both SEQRES and ATOM records:

>d6jy4c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
qthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvir
estfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgihp
lnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyye
apftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawywh
fvdvvwlflyvsiy

Timeline for d6jy4c_:

• d6jy4c_ first appeared in SCOPe 2.07