Lineage for d6jy4c_ (6jy4 C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579677Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2579678Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 2579679Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2579692Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2579693Species Cow (Bos taurus) [TaxId:9913] [81444] (50 PDB entries)
  8. 3074171Domain d6jy4c_: 6jy4 C: [374233]
    Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_
    automated match to d1v54c_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn

Details for d6jy4c_

PDB Entry: 6jy4 (more details), 1.95 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d6jy4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy4c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
qthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvir
estfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgihp
lnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyye
apftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawywh
fvdvvwlflyvsiy

SCOPe Domain Coordinates for d6jy4c_:

Click to download the PDB-style file with coordinates for d6jy4c_.
(The format of our PDB-style files is described here.)

Timeline for d6jy4c_:

  • d6jy4c_ appears in periodic updates to SCOPe 2.07 starting on 2019-09-19