![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) ![]() automatically mapped to Pfam PF00510 |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries) |
![]() | Domain d6jy4c_: 6jy4 C: [374233] Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_ automated match to d1v54c_ complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn |
PDB Entry: 6jy4 (more details), 1.95 Å
SCOPe Domain Sequences for d6jy4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jy4c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} qthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvir estfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgihp lnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyye apftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawywh fvdvvwlflyvsiy
Timeline for d6jy4c_: