SCOPe 2.08: Domain d6jy4i_: 6jy4 I:

Lineage for d6jy4i_ (6jy4 I:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)
   automatically mapped to Pfam PF02937

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries)

8. Domain d6jy4i_: 6jy4 I: [374232]
   Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_
   automated match to d1v54i_
   complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn

Details for d6jy4i_

PDB Entry: 6jy4, 1.95 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully reduced state

PDB Compounds: (I:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d6jy4i_:

Sequence; same for both SEQRES and ATOM records:

>d6jy4i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
mrkagifqsa

Timeline for d6jy4i_:

• d6jy4i_ first appeared in SCOPe 2.07