![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) ![]() automatically mapped to Pfam PF05392 |
![]() | Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81420] (29 PDB entries) |
![]() | Domain d6jy4k_: 6jy4 K: [374208] Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4l_, d6jy4m_ automated match to d1v54k_ complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn |
PDB Entry: 6jy4 (more details), 1.95 Å
SCOPe Domain Sequences for d6jy4k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jy4k_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d6jy4k_: