Lineage for d6jy4k_ (6jy4 K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630638Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 2630639Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 2630640Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630641Species Cow (Bos taurus) [TaxId:9913] [81420] (29 PDB entries)
  8. 2630669Domain d6jy4k_: 6jy4 K: [374208]
    Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4l_, d6jy4m_
    automated match to d1v54k_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn

Details for d6jy4k_

PDB Entry: 6jy4 (more details), 1.95 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (K:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d6jy4k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy4k_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d6jy4k_:

Click to download the PDB-style file with coordinates for d6jy4k_.
(The format of our PDB-style files is described here.)

Timeline for d6jy4k_: