Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Pteropus alecto [TaxId:9402] [374181] (1 PDB entry) |
Domain d6k7ub_: 6k7u B: [374182] automated match to d2xfxb_ |
PDB Entry: 6k7u (more details), 1.6 Å
SCOPe Domain Sequences for d6k7ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k7ub_ b.1.1.2 (B:) automated matches {Pteropus alecto [TaxId: 9402]} eprtpkiqvysrhpaengkpnylncyvygfhppqieidllkngqkmkteqsdlsfskdws fyllvhtdftpstvdeyscrvnhsslaaphmvkwdrn
Timeline for d6k7ub_: