Lineage for d6k7ub_ (6k7u B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753413Species Pteropus alecto [TaxId:9402] [374181] (1 PDB entry)
  8. 2753414Domain d6k7ub_: 6k7u B: [374182]
    automated match to d2xfxb_

Details for d6k7ub_

PDB Entry: 6k7u (more details), 1.6 Å

PDB Description: crystal structure of beta-2 microglobulin (beta2m) of bat (pteropus alecto)
PDB Compounds: (B:) Bat beta-2-microglobulin

SCOPe Domain Sequences for d6k7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k7ub_ b.1.1.2 (B:) automated matches {Pteropus alecto [TaxId: 9402]}
eprtpkiqvysrhpaengkpnylncyvygfhppqieidllkngqkmkteqsdlsfskdws
fyllvhtdftpstvdeyscrvnhsslaaphmvkwdrn

SCOPe Domain Coordinates for d6k7ub_:

Click to download the PDB-style file with coordinates for d6k7ub_.
(The format of our PDB-style files is described here.)

Timeline for d6k7ub_: