Lineage for d6jy3f_ (6jy3 F:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641384Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2641385Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2641386Species Cow (Bos taurus) [TaxId:9913] [57820] (49 PDB entries)
  8. 2641433Domain d6jy3f_: 6jy3 F: [374180]
    Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3b2, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3g_, d6jy3h_, d6jy3i_, d6jy3j_, d6jy3k_, d6jy3l_, d6jy3m_
    automated match to d1v54f_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3f_

PDB Entry: 6jy3 (more details), 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (F:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d6jy3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy3f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
gggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcic
eednstviwfwlhkgeaqrcpscgthyklvp

SCOPe Domain Coordinates for d6jy3f_:

Click to download the PDB-style file with coordinates for d6jy3f_.
(The format of our PDB-style files is described here.)

Timeline for d6jy3f_: