Lineage for d6jy4h_ (6jy4 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327889Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327890Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2327891Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2327892Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2327893Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries)
  8. 2327921Domain d6jy4h_: 6jy4 H: [374162]
    Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_
    automated match to d1v54h_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn

Details for d6jy4h_

PDB Entry: 6jy4 (more details), 1.95 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d6jy4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy4h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOPe Domain Coordinates for d6jy4h_:

Click to download the PDB-style file with coordinates for d6jy4h_.
(The format of our PDB-style files is described here.)

Timeline for d6jy4h_: