Class a: All alpha proteins [46456] (289 folds) |
Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) |
Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
Protein Cytochrome c oxidase subunit h [47696] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries) |
Domain d6jy4h_: 6jy4 H: [374162] Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_ automated match to d1v54h_ complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn |
PDB Entry: 6jy4 (more details), 1.95 Å
SCOPe Domain Sequences for d6jy4h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jy4h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]} yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs twddrraegtfpgki
Timeline for d6jy4h_: