Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [359373] (10 PDB entries) |
Domain d6j34a2: 6j34 A:288-402 [374132] Other proteins in same PDB: d6j34a3, d6j34a4 automated match to d2fhfa1 complexed with act, glc, gol, mg |
PDB Entry: 6j34 (more details), 1.5 Å
SCOPe Domain Sequences for d6j34a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j34a2 b.1.18.0 (A:288-402) automated matches {Klebsiella pneumoniae [TaxId: 573]} yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk
Timeline for d6j34a2: