Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries) |
Domain d6rqna_: 6rqn A: [374060] automated match to d5dvxa_ complexed with act, zn |
PDB Entry: 6rqn (more details), 1.78 Å
SCOPe Domain Sequences for d6rqna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rqna_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hwryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnng hsvqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstky arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps dfsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratq plngrvieasfpagvd
Timeline for d6rqna_: