Lineage for d6hmra_ (6hmr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980262Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2980268Species Human (Homo sapiens) [TaxId:9606] [224941] (25 PDB entries)
  8. 2980292Domain d6hmra_: 6hmr A: [373993]
    Other proteins in same PDB: d6hmrb2
    automated match to d1ckia_
    complexed with ge5, mla

Details for d6hmra_

PDB Entry: 6hmr (more details), 1.78 Å

PDB Description: crystal structure of human casein kinase i delta in complex with a photoswitchable 2-azothiazole-based inhibitor (compound 2)
PDB Compounds: (A:) Casein kinase I isoform delta

SCOPe Domain Sequences for d6hmra_:

Sequence, based on SEQRES records: (download)

>d6hmra_ d.144.1.7 (A:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
nryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgip
tirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfih
rdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthl
gieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgyps
efatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk

Sequence, based on observed residues (ATOM records): (download)

>d6hmra_ d.144.1.7 (A:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
nryrlgrkigsgsfgdiylgtdiaaeevaiklecvktkhpqlhieskiykmmqggvgipt
irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk

SCOPe Domain Coordinates for d6hmra_:

Click to download the PDB-style file with coordinates for d6hmra_.
(The format of our PDB-style files is described here.)

Timeline for d6hmra_: