SCOPe 2.08: Domain d6j1na1: 6j1n A:13-237

Lineage for d6j1na1 (6j1n A:13-237)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Anisodus acutangulus [TaxId:402998] [373942] (2 PDB entries)

8. Domain d6j1na1: 6j1n A:13-237 [373947]
   automated match to d3wd8a1
   complexed with b7x

Details for d6j1na1

PDB Entry: 6j1n, 2.53 Å

PDB Description: anisodus acutangulus type iii polyketide sythase aapks2 in complex with 4-carboxy-3-oxobutanoyl-coa

PDB Compounds: (A:) A. acutangulus PKS2

SCOPe Domain Sequences for d6j1na1:

Sequence; same for both SEQRES and ATOM records:

>d6j1na1 c.95.1.0 (A:13-237) automated matches {Anisodus acutangulus [TaxId: 402998]}
qrsegpalvlaigtatpshwidqssypdyyfrvtnsdhlvdlkekfrricsrtmikkrhm
llteeilkknpnlcsfsepsldirqdilvseipklgkeaalkaiqewaqpkstithlvfc
trsgvdmpgadyqlikllglgpsvqrlmmyqqgcfaggtmlrlakdlaennkgarilvic
aessaigfrgpseshvdnlvaqalfgdgaaaiivgsnpkpglekp

Timeline for d6j1na1:

• d6j1na1 first appeared in SCOPe 2.07