Lineage for d6qh5n_ (6qh5 N:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577424Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 2577437Family d.110.4.2: Clathrin coat assembly domain [75521] (3 proteins)
    automatically mapped to Pfam PF01217
  6. 2577454Protein automated matches [373811] (2 species)
    not a true protein
  7. 2577457Species Rattus norvegicus [TaxId:10116] [373812] (1 PDB entry)
  8. 2577458Domain d6qh5n_: 6qh5 N: [373813]
    Other proteins in same PDB: d6qh5a_, d6qh5b_, d6qh5s_
    automated match to d2vglm1
    complexed with ihp

Details for d6qh5n_

PDB Entry: 6qh5 (more details), 2.56 Å

PDB Description: ap2 clathrin adaptor mu2t156-phosphorylated core in closed conformation
PDB Compounds: (N:) ap-2 complex subunit mu

SCOPe Domain Sequences for d6qh5n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qh5n_ d.110.4.2 (N:) automated matches {Rattus norvegicus [TaxId: 10116]}
migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
pqnsetgalktfitqqgiksq

SCOPe Domain Coordinates for d6qh5n_:

Click to download the PDB-style file with coordinates for d6qh5n_.
(The format of our PDB-style files is described here.)

Timeline for d6qh5n_: