![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.4: SNARE-like [64356] (5 families) ![]() beta(2)-alpha-beta(3)-alpha(2) |
![]() | Family d.110.4.2: Clathrin coat assembly domain [75521] (3 proteins) automatically mapped to Pfam PF01217 |
![]() | Protein automated matches [373811] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [373812] (1 PDB entry) |
![]() | Domain d6qh5n_: 6qh5 N: [373813] Other proteins in same PDB: d6qh5a_, d6qh5b_, d6qh5s_ automated match to d2vglm1 complexed with ihp |
PDB Entry: 6qh5 (more details), 2.56 Å
SCOPe Domain Sequences for d6qh5n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qh5n_ d.110.4.2 (N:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy pqnsetgalktfitqqgiksq
Timeline for d6qh5n_: