Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries) |
Domain d6qigl2: 6qig L:108-213 [373786] Other proteins in same PDB: d6qigh_, d6qigl1 automated match to d1c12a2 complexed with ca, cl, fuc, gol, man, nag, peg, zn |
PDB Entry: 6qig (more details), 2.8 Å
SCOPe Domain Sequences for d6qigl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qigl2 b.1.1.2 (L:108-213) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d6qigl2: