SCOPe 2.08: Domain d6qigl2: 6qig L:108-213

Lineage for d6qigl2 (6qig L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries)

8. Domain d6qigl2: 6qig L:108-213 [373786]
   Other proteins in same PDB: d6qigh_, d6qigl1
   automated match to d1c12a2
   complexed with ca, cl, fuc, gol, man, nag, peg, zn

Details for d6qigl2

PDB Entry: 6qig, 2.8 Å

PDB Description: metalloproteinase

PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d6qigl2:

Sequence; same for both SEQRES and ATOM records:

>d6qigl2 b.1.1.2 (L:108-213) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d6qigl2:

• d6qigl2 first appeared in SCOPe 2.07