Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries) |
Domain d6qigl1: 6qig L:1-107 [373785] Other proteins in same PDB: d6qigh_, d6qigl2 automated match to d1c12a1 complexed with ca, cl, fuc, gol, man, nag, peg, zn |
PDB Entry: 6qig (more details), 2.8 Å
SCOPe Domain Sequences for d6qigl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qigl1 b.1.1.0 (L:1-107) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dieltqapatlsvtpgdrvslscrasqslsnylawyqqksgegprllinyvsqsisgips rfsgsgsgtdytlsinsvetedfgmyfcqqysrlpftfgagtkleik
Timeline for d6qigl1: