![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
![]() | Family a.118.1.10: Clathrin adaptor core protein [74771] (3 proteins) automatically mapped to Pfam PF01602 |
![]() | Protein automated matches [190425] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187313] (5 PDB entries) |
![]() | Domain d6qh5b_: 6qh5 B: [373747] Other proteins in same PDB: d6qh5a_, d6qh5n_, d6qh5s_ automated match to d1gw5b_ complexed with ihp |
PDB Entry: 6qh5 (more details), 2.56 Å
SCOPe Domain Sequences for d6qh5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qh5b_ a.118.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt lltaivklflkkpsetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvtakevvls ekpliseetdlieptlldelichigslasvyhkppnafv
Timeline for d6qh5b_: