Lineage for d6pcub_ (6pcu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757780Domain d6pcub_: 6pcu B: [373736]
    Other proteins in same PDB: d6pcua1, d6pcua2, d6pcud1, d6pcud2, d6pcug1, d6pcug2
    automated match to d4y5ve_
    complexed with gol, so4

Details for d6pcub_

PDB Entry: 6pcu (more details), 2.4 Å

PDB Description: vp8* of a g2p[4] human rotavirus in complex with scfv antibody 9
PDB Compounds: (B:) Variable domain of antibody scFv9

SCOPe Domain Sequences for d6pcub_:

Sequence, based on SEQRES records: (download)

>d6pcub_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqpvltqppsasaslgasvtltctlssgysnykvdwyqqrpgkgprfvmrvgtggivgsk
gdgiadrfsvsgsglnrsltikniqeedesdyhcgadhgsgdnfvrvfgggtkltvlggg
gsggggsggggsqvqlqesgpglvkpsqtlsltcsvsgvslsggsytwnwirqpagkgle
wigriftsgstnynpslkgrltmsidtsknqlslrlssvtaadtavyycvadyyysvpdv
wgqgtpvtvs

Sequence, based on observed residues (ATOM records): (download)

>d6pcub_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqpvltqppsasaslgasvtltctlssgysnykvdwyqqrpgkgprfvmrvgtggivgsk
gdgiadrfsvsgsglnrsltikniqeedesdyhcgadhgsgdnfvrvfgggtkltvlqvq
lqesgpglvkpsqtlsltcsvsgvslsggsytwnwirqpagkglewigriftsgstnynp
slkgrltmsidtsknqlslrlssvtaadtavyycvadyyysvpdvwgqgtpvtvs

SCOPe Domain Coordinates for d6pcub_:

Click to download the PDB-style file with coordinates for d6pcub_.
(The format of our PDB-style files is described here.)

Timeline for d6pcub_: