Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein zeta isoform [48449] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48451] (13 PDB entries) |
Domain d6u2ha_: 6u2h A: [373560] Other proteins in same PDB: d6u2hb2, d6u2hc_, d6u2hd_ automated match to d2v7da_ complexed with 29l |
PDB Entry: 6u2h (more details), 2.5 Å
SCOPe Domain Sequences for d6u2ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u2ha_ a.118.7.1 (A:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]} mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
Timeline for d6u2ha_:
View in 3D Domains from other chains: (mouse over for more information) d6u2hb1, d6u2hb2, d6u2hc_, d6u2hd_ |