Lineage for d6u2ha_ (6u2h A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726478Protein zeta isoform [48449] (2 species)
  7. 2726488Species Human (Homo sapiens) [TaxId:9606] [48451] (13 PDB entries)
  8. 2726513Domain d6u2ha_: 6u2h A: [373560]
    Other proteins in same PDB: d6u2hb2, d6u2hc_, d6u2hd_
    automated match to d2v7da_
    complexed with 29l

Details for d6u2ha_

PDB Entry: 6u2h (more details), 2.5 Å

PDB Description: braf dimer bound to 14-3-3
PDB Compounds: (A:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d6u2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u2ha_ a.118.7.1 (A:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d6u2ha_:

Click to download the PDB-style file with coordinates for d6u2ha_.
(The format of our PDB-style files is described here.)

Timeline for d6u2ha_: