![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.7: ML domain [81287] (3 proteins) implicated in lipid recognition, particularly in the recognition of pathogen related products automatically mapped to Pfam PF02221 |
![]() | Protein automated matches [321839] (2 species) not a true protein |
![]() | Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [373528] (1 PDB entry) |
![]() | Domain d6oy4a_: 6oy4 A: [373529] Other proteins in same PDB: d6oy4c1, d6oy4c2, d6oy4d_ automated match to d1xwva_ complexed with so4 |
PDB Entry: 6oy4 (more details), 2.45 Å
SCOPe Domain Sequences for d6oy4a_:
Sequence, based on SEQRES records: (download)
>d6oy4a_ b.1.18.7 (A:) automated matches {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} dqvdvkdcanheikkvlvpgchgsepciihrgkpfqlealfeanqnsktakieikasidg levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgdngvlaca iathakird
>d6oy4a_ b.1.18.7 (A:) automated matches {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} dqvdvkdcanheikkvlvpgchgsepciihrgkpfqlealfeanqnsakieikasidgle vdvpgidpnachymlvkgqqydikytwnvpkiapksenvvvtvkvdngvlacaiathaki rd
Timeline for d6oy4a_: