Lineage for d6k9vc1 (6k9v C:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863314Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)
  8. 2863770Domain d6k9vc1: 6k9v C:1-245 [373515]
    Other proteins in same PDB: d6k9va2, d6k9vb2, d6k9vc2, d6k9vd2, d6k9ve_, d6k9vf1, d6k9vf2, d6k9vf3
    automated match to d5fnva1
    complexed with acp, ca, d3l, gdp, gtp, mes, mg

Details for d6k9vc1

PDB Entry: 6k9v (more details), 2.54 Å

PDB Description: crystal structure of tubulin in complex with inhibitor d64
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6k9vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k9vc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d6k9vc1:

Click to download the PDB-style file with coordinates for d6k9vc1.
(The format of our PDB-style files is described here.)

Timeline for d6k9vc1: