SCOPe 2.08: Domain d6oy4c2: 6oy4 C:113-216

Lineage for d6oy4c2 (6oy4 C:113-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6oy4c2: 6oy4 C:113-216 [373500]
   Other proteins in same PDB: d6oy4a_, d6oy4c1, d6oy4d_
   automated match to d1v7ml2
   complexed with so4

Details for d6oy4c2

PDB Entry: 6oy4, 2.45 Å

PDB Description: crystal structure of complex between recombinant der p 2.0103 and fab fragment of 7a1

PDB Compounds: (C:) Fab fragment of IgG, HEAVY CHAIN

SCOPe Domain Sequences for d6oy4c2:

Sequence; same for both SEQRES and ATOM records:

>d6oy4c2 b.1.1.2 (C:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvawkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d6oy4c2:

• d6oy4c2 first appeared in SCOPe 2.07