SCOPe 2.08: Domain d6obhd2: 6obh D:148-221

Lineage for d6obhd2 (6obh D:148-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)

8. Domain d6obhd2: 6obh D:148-221 [373465]
   Other proteins in same PDB: d6obha1, d6obhb1, d6obhc1, d6obhd1, d6obhe1, d6obhf1
   automated match to d2m8pa2
   complexed with na

Details for d6obhd2

PDB Entry: 6obh, 2.96 Å

PDB Description: structure of hiv-1 ca 1/2-hexamer

PDB Compounds: (D:) ca

SCOPe Domain Sequences for d6obhd2:

Sequence; same for both SEQRES and ATOM records:

>d6obhd2 a.28.3.0 (D:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqgv

Timeline for d6obhd2:

• d6obhd2 first appeared in SCOPe 2.07