Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (9 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
Domain d6k9vd1: 6k9v D:1-243 [373448] Other proteins in same PDB: d6k9va2, d6k9vb2, d6k9vc2, d6k9vd2, d6k9ve_, d6k9vf1, d6k9vf2, d6k9vf3 automated match to d4drxb1 complexed with acp, ca, d3l, gdp, gtp, mes, mg |
PDB Entry: 6k9v (more details), 2.54 Å
SCOPe Domain Sequences for d6k9vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k9vd1 c.32.1.1 (D:1-243) automated matches {Cow (Bos taurus) [TaxId: 9913]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d6k9vd1: