Lineage for d6qjwa2 (6qjw A:68-208)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) Species Escherichia coli [TaxId:562] [48501] (37 PDB entries) 
Domain d6qjwa2: 6qjw A:68-208 [373280]
Other proteins in same PDB: d6qjwa1
automated match to d2xpwa2
complexed with cl, ctc, mg; mutant
Details for d6qjwa2
PDB Entry: 6qjw (more details), 2.1 Å
PDB Description: tetr(d) t103a mutant in complex with 7-chlortetracycline and magnesium
PDB Compounds: (A:) tetracycline repressor protein class dSCOPe Domain Sequences for d6qjwa2:
Sequence, based on SEQRES records: (download)
>d6qjwa2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgarpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv
Sequence, based on observed residues (ATOM records): (download)
>d6qjwa2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgarpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv
SCOPe Domain Coordinates for d6qjwa2:
Click to download the PDB-style file with coordinates for d6qjwa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6qjwa2:
- d6qjwa2 first appeared in SCOPe 2.07
View in 3D
