Lineage for d1e01a_ (1e01 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324858Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 324859Superfamily d.7.1: LysM domain [54106] (1 family) (S)
  5. 324860Family d.7.1.1: LysM domain [54107] (1 protein)
  6. 324861Protein Membrane-bound lytic murein transclycosylase D, MltD [54108] (1 species)
  7. 324862Species Escherichia coli [TaxId:562] [54109] (2 PDB entries)
  8. 324863Domain d1e01a_: 1e01 A: [37326]

Details for d1e01a_

PDB Entry: 1e01 (more details)

PDB Description: lysm domain from e.coli mltd

SCOP Domain Sequences for d1e01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e01a_ d.7.1.1 (A:) Membrane-bound lytic murein transclycosylase D, MltD {Escherichia coli}
dsityrvrkgdslssiakrhgvnikdvmrwnsdtanlqpgdkltlfvk

SCOP Domain Coordinates for d1e01a_:

Click to download the PDB-style file with coordinates for d1e01a_.
(The format of our PDB-style files is described here.)

Timeline for d1e01a_: