SCOPe 2.08: Domain d6agke_: 6agk E:

Lineage for d6agke_ (6agk E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d6agke_: 6agk E: [373097]
   Other proteins in same PDB: d6agka1, d6agka2, d6agkb1, d6agkb2, d6agkc1, d6agkc2, d6agkd1, d6agkd2, d6agkf1, d6agkf2
   automated match to d4i55e_
   complexed with 9wr, acp, ca, gdp, gtp, mes, mg

Details for d6agke_

PDB Entry: 6agk, 2.8 Å

PDB Description: the structure of ch-ii-77-tubulin complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6agke_:

Sequence, based on SEQRES records:

>d6agke_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d6agke_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

Timeline for d6agke_:

• d6agke_ first appeared in SCOPe 2.07