Lineage for d6pe9l1 (6pe9 L:1-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (223 PDB entries)
  8. 3073002Domain d6pe9l1: 6pe9 L:1-113 [373064]
    Other proteins in same PDB: d6pe9b2, d6pe9d2, d6pe9f2, d6pe9l2, d6pe9m_
    automated match to d4rgne1
    complexed with so4

Details for d6pe9l1

PDB Entry: 6pe9 (more details), 3.13 Å

PDB Description: crystal structure of cd40 complexed to fab516
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6pe9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pe9l1 b.1.1.1 (L:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleik

SCOPe Domain Coordinates for d6pe9l1:

Click to download the PDB-style file with coordinates for d6pe9l1.
(The format of our PDB-style files is described here.)

Timeline for d6pe9l1:

  • d6pe9l1 appears in periodic updates to SCOPe 2.07 starting on 2019-08-15