Lineage for d1agi__ (1agi -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77162Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 77163Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 77164Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 77165Protein Angiogenin [54094] (2 species)
  7. 77166Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries)
  8. 77167Domain d1agi__: 1agi - [37303]

Details for d1agi__

PDB Entry: 1agi (more details), 1.5 Å

PDB Description: crystal structure of bovine angiogenin at 1.5 angstroms resolution

SCOP Domain Sequences for d1agi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agi__ d.5.1.1 (-) Angiogenin {Cow (Bos taurus)}
aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
itprh

SCOP Domain Coordinates for d1agi__:

Click to download the PDB-style file with coordinates for d1agi__.
(The format of our PDB-style files is described here.)

Timeline for d1agi__: