SCOPe 2.08: Domain d6nw0a_: 6nw0 A:

Lineage for d6nw0a_ (6nw0 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubredoxin [57804] (8 species)

7. Species Desulfovibrio desulfuricans, strain 27774 [TaxId:876] [57807] (3 PDB entries)

8. Domain d6nw0a_: 6nw0 A: [373008]
   automated match to d6rxna_
   complexed with ni

Details for d6nw0a_

PDB Entry: 6nw0, 1.85 Å

PDB Description: crystal structure desulfovibrio desulfuricans nickel-substituted rubredoxin

PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d6nw0a_:

Sequence; same for both SEQRES and ATOM records:

>d6nw0a_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]}
mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgvskdqfspa

Timeline for d6nw0a_:

• d6nw0a_ first appeared in SCOPe 2.07