![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
![]() | Protein Rubredoxin [57804] (8 species) |
![]() | Species Desulfovibrio desulfuricans, strain 27774 [TaxId:876] [57807] (3 PDB entries) |
![]() | Domain d6nw0b_: 6nw0 B: [372995] automated match to d6rxna_ complexed with ni |
PDB Entry: 6nw0 (more details), 1.85 Å
SCOPe Domain Sequences for d6nw0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nw0b_ g.41.5.1 (B:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgvskdqfspa
Timeline for d6nw0b_: