Lineage for d6nw0b_ (6nw0 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036509Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 3036518Protein Rubredoxin [57804] (8 species)
  7. 3036550Species Desulfovibrio desulfuricans, strain 27774 [TaxId:876] [57807] (3 PDB entries)
  8. 3036555Domain d6nw0b_: 6nw0 B: [372995]
    automated match to d6rxna_
    complexed with ni

Details for d6nw0b_

PDB Entry: 6nw0 (more details), 1.85 Å

PDB Description: crystal structure desulfovibrio desulfuricans nickel-substituted rubredoxin
PDB Compounds: (B:) rubredoxin

SCOPe Domain Sequences for d6nw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nw0b_ g.41.5.1 (B:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]}
mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgvskdqfspa

SCOPe Domain Coordinates for d6nw0b_:

Click to download the PDB-style file with coordinates for d6nw0b_.
(The format of our PDB-style files is described here.)

Timeline for d6nw0b_: