Lineage for d6nw1b_ (6nw1 B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587652Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2587778Protein automated matches [190785] (6 species)
    not a true protein
  7. 3072929Species Desulfovibrio desulfuricans [TaxId:876] [372991] (1 PDB entry)
  8. 3072930Domain d6nw1b_: 6nw1 B: [372992]
    Other proteins in same PDB: d6nw1a_
    automated match to d6rxna_
    complexed with ni

Details for d6nw1b_

PDB Entry: 6nw1 (more details), 1.86 Å

PDB Description: crystal structure desulfovibrio desulfuricans nickel-substituted rubredoxin v37n
PDB Compounds: (B:) rubredoxin

SCOPe Domain Sequences for d6nw1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nw1b_ g.41.5.1 (B:) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgnskdqfspa

SCOPe Domain Coordinates for d6nw1b_:

Click to download the PDB-style file with coordinates for d6nw1b_.
(The format of our PDB-style files is described here.)

Timeline for d6nw1b_:

  • d6nw1b_ is new in SCOPe 2.07-stable