Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Escherichia coli [TaxId:562] [226067] (7 PDB entries) |
Domain d6i5fb4: 6i5f B:567-799 [372920] Other proteins in same PDB: d6i5fa1, d6i5fa2, d6i5fa3, d6i5fb1, d6i5fb2, d6i5fb3 automated match to d1wb9a2 complexed with adp, gol, so4; mutant |
PDB Entry: 6i5f (more details), 2.6 Å
SCOPe Domain Sequences for d6i5fb4:
Sequence, based on SEQRES records: (download)
>d6i5fb4 c.37.1.0 (B:567-799) automated matches {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesi
>d6i5fb4 c.37.1.0 (B:567-799) automated matches {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgrstfmvemtetanilhnateyslvlmde igrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgd tiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesi
Timeline for d6i5fb4:
View in 3D Domains from other chains: (mouse over for more information) d6i5fa1, d6i5fa2, d6i5fa3, d6i5fa4 |