Lineage for d6i5fb2 (6i5f B:117-269)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495564Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) (S)
  5. 2495592Family c.55.6.0: automated matches [254201] (1 protein)
    not a true family
  6. 2495593Protein automated matches [254441] (1 species)
    not a true protein
  7. 2495594Species Escherichia coli [TaxId:562] [254938] (3 PDB entries)
  8. 2495600Domain d6i5fb2: 6i5f B:117-269 [372918]
    Other proteins in same PDB: d6i5fa1, d6i5fa3, d6i5fa4, d6i5fb1, d6i5fb3, d6i5fb4
    automated match to d1wb9a3
    complexed with adp, gol, so4; mutant

Details for d6i5fb2

PDB Entry: 6i5f (more details), 2.6 Å

PDB Description: crystal structure of dna-free e.coli muts p839e dimer mutant
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d6i5fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5fb2 c.55.6.0 (B:117-269) automated matches {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOPe Domain Coordinates for d6i5fb2:

Click to download the PDB-style file with coordinates for d6i5fb2.
(The format of our PDB-style files is described here.)

Timeline for d6i5fb2: