SCOPe 2.08: Domain d6h4gb2: 6h4g B:355-490

Lineage for d6h4gb2 (6h4g B:355-490)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (20 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:185431] [372827] (2 PDB entries)

8. Domain d6h4gb2: 6h4g B:355-490 [372859]
   automated match to d4jv4a2
   complexed with cmp, nos; mutant

Details for d6h4gb2

PDB Entry: 6h4g, 2.14 Å

PDB Description: regulatory subunit of a camp-independent protein kinase a from trypanosoma brucei: e311a, t318r, v319a mutant bound to camp in the a site

PDB Compounds: (B:) Protein kinase A regulatory subunit

SCOPe Domain Sequences for d6h4gb2:

Sequence; same for both SEQRES and ATOM records:

>d6h4gb2 b.82.3.0 (B:355-490) automated matches {Trypanosoma brucei [TaxId: 185431]}
iqfltnipflsgldnyeklqladalssdefepgdyiirygeegewlyiilegsvdvvgrd
ddgnekhvwefgkgdhvgeleflnnhanvadvvakthvvtaklnrrhfemclgpvidvlk
rtsqqpnyeyyqsklk

Timeline for d6h4gb2:

• d6h4gb2 first appeared in SCOPe 2.07